Current Assignee: Shanghai National Engineering Research Center for Nanotechnology Co Ltd
2020-09-27: Application filed by Shanghai National Engineering Research Center for Nanotechnology Co Ltd
Abstract:
The invention belongs to the field of nano materials and biomedicine, and relates to a vaccine, in particular to development of 2019-nCoV coronavirus nuclear recombinant nano vaccine. The invention also comprises a preparation method of the vaccine and application of the vaccine in animal experiments. The new corona vaccine contains graphene oxide, carnosine, CpG and new corona virus RBD; binding carnosine, CpG and neocoronavirus RBD on the backbone of graphene oxide; the CpG coding sequence is shown as SEQ ID NO 1; the novel coronavirus RBD refers to a novel coronavirus protein receptor binding region which can generate a high-titer specific antibody aiming at the RBD in a mouse body, and provides a strong support for prevention and treatment of the novel coronavirus.
Disclosure of Invention:
・The invention aims to provide a coronavirus recombinant vaccine.
・Another purpose of the invention is to provide a preparation method of the virus recombinant vaccine.
・It is still another object of the present invention to provide the use of the recombinant vaccine of the virus.
Description - Technical Field:
In one aspect, the invention provides a coronavirus vaccine comprising graphene oxide, carnosine, CpG, and RBD. In a preferred embodiment of the invention, the vaccine is named GO-Car-carnosine-CpG-RBD vaccine.
Graphene Oxide (GO) is an oxide of graphene, and after oxidation, oxygen-containing functional groups on the graphene oxide are increased, so that the graphene oxide is more active than graphene. For example, hydroxyl groups and epoxy groups are randomly distributed on a graphene oxide monolith, while carboxyl groups and carbonyl groups are introduced at the edge of the monolith. Common commercial products of graphene oxide are in the form of powder, flakes and solutions, and are brown-yellow in color.
Carnosine, known by the scientific name β -alanyl-L-histidine, is a crystalline solid composed of a dipeptide consisting of two amino acids, β -alanine and L-histidine. Carnosine has strong antioxidant ability, and can scavenge Reactive Oxygen Species (ROS) and alpha-beta unsaturated aldehydes, which are formed by over-oxidation of fatty acids in cell membranes during oxidative stress.
CpG motifs have the effect of activating the body's immune system and can be used as adjuvants. Preferably, the CpG coding sequence is shown as SEQ ID NO 1.
RBD (spike receptor binding domain), specifically a coronavirus protein (S protein) Receptor Binding Domain (RBD) in the present invention. For example, the RBD protein can be selected as follows:
PNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAP (SEQ ID NO 2).
※ The coronavirus vaccine disclosed by the invention is obtained by combining carnosine, CpG and a novel coronavirus RBD on activated graphene oxide.
BTW, as you know graphene oxide (GO) is the main ingredient used in hydrogels. Hydrogels are developed by DARPA and used in the Covid vaccines.
Article describing how DARPA is developing hydrogels to use with Covid-19 detection.
"Hydrogels being a material whose network of polymer chains is used in some contact lenses and other implants. Inserted under the skin with a syringe, the string includes a specially engineered molecule that sends a fluorescent signal outside of the body when the body begins to fight an infection. The other part is an electronic component attached to the skin. It sends light through the skin, detects the fluorescent signal and generates another signal that the wearer can send to a doctor, website, etc. It’s like a blood lab on the skin that can pick up the body’s response to illness before the presence of other symptoms, like coughing."
What Effects Does Graphene Oxide (GO) have on the Body ?
As GO can directly act on the respiratory system, research has mainly focused on GO induced damage to this system. ... Previous studies on the toxic effects of GO have primarily focused on mitochondrial damage, DNA damage, the inflammatory response, apoptosis and oxidative stress
Pfizer EUA filing lists 4 LNPs in the V with CAS numbers. Moderna provides a material Safety Datasheet for each LNP with CAS numbers.
When I searched MSDS + CAS number (of the LNPs) it came up with SINOPEG as the manufacturer - a company in China ! On the Sinopeg website is a tab called "Covid19 excipients". The Sinopeg website explains the nature of GO in an article called-
"CORE-SHELL STRUCTURED POLYETHYLENE GLYCOL FUNCTIONALISED GRAPHENE OXIDE FOR ENERGY STORAGE POLYMER DIELECTRICS."
Sinopeg regard the function of GO as ENERGY STORAGE in the form of CHARGE (dielectric)- this energy being absorbed as electromagnetic radiation. It is the main ingredient. It serves as an interface between an organism and the internet of things. It is normally neutral, but in an EM field will become positively charged. Positively charged GO will destroy anything (biological) it comes in contact with.
・GO Will Produce Sensitivity to EM Fields. "GO is a conductor of electricity". It is a great conductor of electricity, and it can host a magnetic field, so it can literally interact with the internet.
・GO is the "main ingredient in hydrogel". If GO is in the vaccine, then vaccinated people should be highly sensitive to electro-magnetic.
・(EM) fields, since EM fields will induce an electrical charge in the GO which will naturally disturb the electrical nerve signals in the human body. Also the movement of ions throughout the body will be disturbed.
So GO isn't necessarily a means of controlling the population; rather it lends itself to a blunter use - a general dysregulation of bodily functions inducible with the on/off precision of a switch.
Every molecule and every chemical has an absorption spectrum – and there are specific frequencies where it absorbs energy the most.
GO is currently used to absorb electromagnetic radiation in the 5G wavebands. There are different graphene nanostructures, and the wavelengths where they absorb the most radiation are between 6 GHz and 18 GHz - in other words- just above 4G but below the high frequency 5G. This means that when GO is exposed to radiation of higher frequency than 4G, it will absorb...
Great article, thank you for elucidating on "The Illusion of Rivalry".
While there are indeed factions of sociopaths and psychopaths competing for dominance, many fail to realize these factions are operating within the same technocratic, transhumanist, eugenics rooted slavery system.
People here keep falling back on the old programmed thought of there being "good guy countries" and "bad guy countries" (while they fail to see all of these countries exist under the umbrella of the same corporatocracy). This is a very effective distraction which is leading a great many to latch onto false hopes of various "knight in shining armor" stories. These attitude are the result of effective forms of psychological warfare which encourage people to tell themselves the comforting and infantilizing story that "if I just sit tight and vote or cheer for the right person, everything will work out okay for me in the end". Here in Canada there are people who have put Pierre Poilievre on that pedestal, in the States some put Bernie or Trump or even Elon Musk on that pedestal, and some even put Putin on that pedestal too.. sadly, those involved in putting their faith in such individuals have a rude awakening in store for them.
Keep up the great work, stay safe and keep on planting those seeds (literal and metaphorical seeds) my friend.
"Kirill Dmitriev, the WEF Young Global Leader and CEO of Russia’s Direct Investment Fund, received a scholarship from the Soros Foundation? Now you know." Charming, absolutely charming. Can't wait for the next Facebook fawning Putin fan to tell me how Putin and Russia are all about opposing Soros's plans for a new world order.
Speaking of which, here is a gem from over 10 years ago, then-World Bank president Robert Zoellick, former US trade rep and a Council on Foreign Relations insider, spoke on the need to move to a more "multilateral" (multi-polar) world order.
The Coming Multilateral World Order. World Bank head Robert Zoellick sees a tomorrow in which developing countries wield more power, societies succeed or fail as they empower women, and development moves beyond aid. Stewart M. Patrick, 9/29/11.
t's rare that the head of a lumbering international organization delivers a visionary speech about a new world order. But when that person is a polymath and strategic thinker like Robert Zoellick, it pays to sit up and take notice. In a sweeping address at George Washington University earlier this month, the World Bank president identified a "critical inflection point" in world history. Global affairs have been so transformed, he suggested, that we need new paradigms for global governance and global development. Since the speech attracted little media attention, The Internationalist thought it opportune to take a closer look.....
The ground is shifting under our feet. Economic and political power is flowing to developing countries at an unprecedented speed. In the 1990s, developing countries collectively accounted for a fifth of global growth. By 2025, six of the biggest emerging economies--China, India, Brazil, South Korea, Russia and Indonesia--will account for half. Based on its current trajectory, China may quadruple its per capita income to $16,000 by 2030--"equivalent to adding sixteen South Koreas each year." For the world to absorb such dramatic changes, China and other rapid ascenders must shift from export-led to more balanced growth. Simultaneously, mature economies like the United States, the European Union, and Japan need to overcome political gridlock and make difficult fiscal choices--or face inevitable decline.
• The time has come to retire old labels and habits. Five decades after decolonization (and two after the Cold War), the shopworn labels "First World" and "Third World" and "North" and "South," make no sense. It is time to stop treating developing nations as mere aid "supplicants"--wards of the wealthy nations--and start treating them as full partners in the pursuit of shared global growth. Nor can the rich world continue to pretend that it has all the answers, patronizing developing nations with aid conditions and policy guidance when its own recent performance has been so dismal. Increasingly, developing countries are looking to one another for innovative economic ideas and development models--whether it is Brazil's successful program of conditional cash transfers or Colombia's mass transit system--and as sources of investment and even foreign aid.
• Tomorrow's multilateral order will be fluid and volatile. In the twenty-first century, global governance will be more flexible, but also more subject to shocks. Old hierarchies will be pushed aside, as emerging economies join "new networks--of countries, international institutions, civil society, and the private sector--in diverse combinations and changing patterns." Long-established patterns of Western privilege will fade: "The New Normal will be about countries continually earning their place in world economic affairs, not presuming it because of past standing or official prerogatives."
True news article - not sarcasm. The Food and Drug Administration has granted emergency use authorization to a new CONVID-19 test that can detect infections with only a sample of a patient's breath, using a device that can yield results in less than three minutes.
The InspectIR CONVID-19 Breathalyzer is a piece of equipment around the size of a piece of carry-on luggage. Each InspectIR Breathalyzer can evaluate around 160 samples every day. In a study of 2,409 people with and without symptoms, the FDA says the device was able to spot 91.2% of cases — and yielded false positives in only 0.7% of results.
InspectIR's test works by analyzing a person's breath using "gas chromatography gas mass-spectrometry" to detect "five compounds" typically exhaled when people are infected by SARS-CoV-2. Of course the article neglects to disclose the "5 compounds".
Great stuff my friend, will finish reading the article after work.
Meanwhile here in Canada our government is pre-emptively preparing a program to pay off the surviving family members (providing "funeral expenses" etc) and paying off some of the maimed victims of the clot shots they forced on everyone, and this is apparently just a program for "the first five years" of vaccine deaths and injuries they are predicting. https://tnc.news/2022/03/17/feds-prepare-75-million-for-first-five-years-of-covid-vaccine-injury-claims/
"They started with the freezing of the assets of Russian oligarchs in the West, a measure that was applauded by the Russian population, which considers them illegitimate beneficiaries of the plundering of the USSR."
You've remarked on such things before, iirc, E.S.
Seems like it's time for many wolves to be tossed by their fellow wolves to their fellow wolves. If Putin's primary goal is to remain the last man standing, then his less flattering maneuvers -- from going full-bore covid-compliant to allowing so much wealth to be stolen -- make sense. Nothing else computes for me in a way that doesn't make my head want to explode like a Moshka ammunition hold.
As strong as Russia's position in so many ways is, it is nonetheless in the center of a vicious market-state vs nation-state Global Transformation War, and Putin may be wise enough to see that Russia as he knows it must politically collapse and, if so, he would logically want to have deciding power on who takes over the inescapable mess.
Either way, Russia is a mess that is well-stocked in international Brawndo: it has the abundant natural resources that global market/nation-states crave (along with a well-maintained tech infrastructure despite serious population problems); it currently can project the world's largest single military power; and it has a sense of national identity every bit as strong as China's national identity (China's national ID has yet to be re-determined after being conquered and consistently bled to death for nearly 200 years by Euromerican parasites).
Even with the several self-inflicted or merely unavoidable wounds it has taken on in recent years, Russia retains the global catbird seat and I therefore choose to believe that Putin's seemingly cretinous acquiescence to dopey death fads like Covidiotics!(r) and Trust USA to Play Fair is that of a man determined to preserve core control over an inescapable maniacal clusterfuck, one that is already waging full-blown economic and biological warfare including "Fauci's" creepy crawlers, and seems quite capable of becoming a nuclear attention-getter that might even cancel next year's Oscar ceremony.
Times are sad indeed when the best one's hopes can sustain are like some Hollywood flick where the hero has to detonate the Twin Towers himself, while inside, and survive the blast or at least die with the One Ring clutched to his vaporized breast.
I mean: Putin. As an action hero political icon, his sell-by was ten years ago when he still looked good riding bare-chested on a horse with his manly manipples budding like mojo detonator switches. I mean, hey: the dude used to be cool. Show me another superpower president doing this:
There's always a hypodermic needle in those Soviet-era cartoons of the capitalist pugs -- never quite figured out why.
Strangely, those old caricatures tell us something about today's unusual alliances. Perhaps the dawning realization that Ukraine's fighters are a stalking horse for moneyed interests who aim to profit from their fight with Russia.
Vlad's got quite a legacy - this little bit of rather poisonous corruption, what appears to be a losing war in Ukraine because he surrounded himself with "yes men", some of whom are now cooling their heels in Lefortovo, and now the Moskva, put out of action either by a couple of Ukrainian anti-ship missiles, "incompetence", or both ...
My friend wrote a song about hacksxxxine death
You can hear it in my substack , latest post, and a short story about it's inception...
Hard as Hell
Regards
Edward, Posted on the usual…😎⬇️👍
First, Edward said, "Click," and I was like, 'You're not the boss of me.'
Then, he said, "Clickety-click"...and I gotta admit, I'm now sitting here combatting a powerful urge to clickety-click...
Good morning Edward !
A company called SHANGHAI NANOTECH filed a patent for using Graphen Oxide in Covid19 vaccines in August 2020. For this patent see here.
＊Nano coronavirus recombinant vaccine taking graphene oxide as carrier
https://patents.google.com/patent/CN112220919A/en?oq=CN112220919A
Inventor: 崔大祥, 高昂, 梁辉, 田静, 李雪玲, 沈琦
Current Assignee: Shanghai National Engineering Research Center for Nanotechnology Co Ltd
2020-09-27: Application filed by Shanghai National Engineering Research Center for Nanotechnology Co Ltd
Abstract:
The invention belongs to the field of nano materials and biomedicine, and relates to a vaccine, in particular to development of 2019-nCoV coronavirus nuclear recombinant nano vaccine. The invention also comprises a preparation method of the vaccine and application of the vaccine in animal experiments. The new corona vaccine contains graphene oxide, carnosine, CpG and new corona virus RBD; binding carnosine, CpG and neocoronavirus RBD on the backbone of graphene oxide; the CpG coding sequence is shown as SEQ ID NO 1; the novel coronavirus RBD refers to a novel coronavirus protein receptor binding region which can generate a high-titer specific antibody aiming at the RBD in a mouse body, and provides a strong support for prevention and treatment of the novel coronavirus.
Disclosure of Invention:
・The invention aims to provide a coronavirus recombinant vaccine.
・Another purpose of the invention is to provide a preparation method of the virus recombinant vaccine.
・It is still another object of the present invention to provide the use of the recombinant vaccine of the virus.
Description - Technical Field:
In one aspect, the invention provides a coronavirus vaccine comprising graphene oxide, carnosine, CpG, and RBD. In a preferred embodiment of the invention, the vaccine is named GO-Car-carnosine-CpG-RBD vaccine.
Graphene Oxide (GO) is an oxide of graphene, and after oxidation, oxygen-containing functional groups on the graphene oxide are increased, so that the graphene oxide is more active than graphene. For example, hydroxyl groups and epoxy groups are randomly distributed on a graphene oxide monolith, while carboxyl groups and carbonyl groups are introduced at the edge of the monolith. Common commercial products of graphene oxide are in the form of powder, flakes and solutions, and are brown-yellow in color.
Carnosine, known by the scientific name β -alanyl-L-histidine, is a crystalline solid composed of a dipeptide consisting of two amino acids, β -alanine and L-histidine. Carnosine has strong antioxidant ability, and can scavenge Reactive Oxygen Species (ROS) and alpha-beta unsaturated aldehydes, which are formed by over-oxidation of fatty acids in cell membranes during oxidative stress.
CpG motifs have the effect of activating the body's immune system and can be used as adjuvants. Preferably, the CpG coding sequence is shown as SEQ ID NO 1.
RBD (spike receptor binding domain), specifically a coronavirus protein (S protein) Receptor Binding Domain (RBD) in the present invention. For example, the RBD protein can be selected as follows:
PNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAP (SEQ ID NO 2).
※ The coronavirus vaccine disclosed by the invention is obtained by combining carnosine, CpG and a novel coronavirus RBD on activated graphene oxide.
BTW, as you know graphene oxide (GO) is the main ingredient used in hydrogels. Hydrogels are developed by DARPA and used in the Covid vaccines.
Article describing how DARPA is developing hydrogels to use with Covid-19 detection.
"Hydrogels being a material whose network of polymer chains is used in some contact lenses and other implants. Inserted under the skin with a syringe, the string includes a specially engineered molecule that sends a fluorescent signal outside of the body when the body begins to fight an infection. The other part is an electronic component attached to the skin. It sends light through the skin, detects the fluorescent signal and generates another signal that the wearer can send to a doctor, website, etc. It’s like a blood lab on the skin that can pick up the body’s response to illness before the presence of other symptoms, like coughing."
https://www.defenseone.com/technology/2020/03/military-funded-biosensor-could-be-future-pandemic-detection/163497/
What Effects Does Graphene Oxide (GO) have on the Body ?
As GO can directly act on the respiratory system, research has mainly focused on GO induced damage to this system. ... Previous studies on the toxic effects of GO have primarily focused on mitochondrial damage, DNA damage, the inflammatory response, apoptosis and oxidative stress
https://www.spandidos-publications.com/10.3892/etm.2021.9893
Pfizer EUA filing lists 4 LNPs in the V with CAS numbers. Moderna provides a material Safety Datasheet for each LNP with CAS numbers.
When I searched MSDS + CAS number (of the LNPs) it came up with SINOPEG as the manufacturer - a company in China ! On the Sinopeg website is a tab called "Covid19 excipients". The Sinopeg website explains the nature of GO in an article called-
"CORE-SHELL STRUCTURED POLYETHYLENE GLYCOL FUNCTIONALISED GRAPHENE OXIDE FOR ENERGY STORAGE POLYMER DIELECTRICS."
Sinopeg regard the function of GO as ENERGY STORAGE in the form of CHARGE (dielectric)- this energy being absorbed as electromagnetic radiation. It is the main ingredient. It serves as an interface between an organism and the internet of things. It is normally neutral, but in an EM field will become positively charged. Positively charged GO will destroy anything (biological) it comes in contact with.
・GO Will Produce Sensitivity to EM Fields. "GO is a conductor of electricity". It is a great conductor of electricity, and it can host a magnetic field, so it can literally interact with the internet.
・GO is the "main ingredient in hydrogel". If GO is in the vaccine, then vaccinated people should be highly sensitive to electro-magnetic.
・(EM) fields, since EM fields will induce an electrical charge in the GO which will naturally disturb the electrical nerve signals in the human body. Also the movement of ions throughout the body will be disturbed.
So GO isn't necessarily a means of controlling the population; rather it lends itself to a blunter use - a general dysregulation of bodily functions inducible with the on/off precision of a switch.
Every molecule and every chemical has an absorption spectrum – and there are specific frequencies where it absorbs energy the most.
GO is currently used to absorb electromagnetic radiation in the 5G wavebands. There are different graphene nanostructures, and the wavelengths where they absorb the most radiation are between 6 GHz and 18 GHz - in other words- just above 4G but below the high frequency 5G. This means that when GO is exposed to radiation of higher frequency than 4G, it will absorb...
Take care of yourself...
Great article, thank you for elucidating on "The Illusion of Rivalry".
While there are indeed factions of sociopaths and psychopaths competing for dominance, many fail to realize these factions are operating within the same technocratic, transhumanist, eugenics rooted slavery system.
People here keep falling back on the old programmed thought of there being "good guy countries" and "bad guy countries" (while they fail to see all of these countries exist under the umbrella of the same corporatocracy). This is a very effective distraction which is leading a great many to latch onto false hopes of various "knight in shining armor" stories. These attitude are the result of effective forms of psychological warfare which encourage people to tell themselves the comforting and infantilizing story that "if I just sit tight and vote or cheer for the right person, everything will work out okay for me in the end". Here in Canada there are people who have put Pierre Poilievre on that pedestal, in the States some put Bernie or Trump or even Elon Musk on that pedestal, and some even put Putin on that pedestal too.. sadly, those involved in putting their faith in such individuals have a rude awakening in store for them.
Keep up the great work, stay safe and keep on planting those seeds (literal and metaphorical seeds) my friend.
"Kirill Dmitriev, the WEF Young Global Leader and CEO of Russia’s Direct Investment Fund, received a scholarship from the Soros Foundation? Now you know." Charming, absolutely charming. Can't wait for the next Facebook fawning Putin fan to tell me how Putin and Russia are all about opposing Soros's plans for a new world order.
Speaking of which, here is a gem from over 10 years ago, then-World Bank president Robert Zoellick, former US trade rep and a Council on Foreign Relations insider, spoke on the need to move to a more "multilateral" (multi-polar) world order.
https://www.theatlantic.com/international/archive/2011/09/the-coming-multilateral-world-order/245845/
The Coming Multilateral World Order. World Bank head Robert Zoellick sees a tomorrow in which developing countries wield more power, societies succeed or fail as they empower women, and development moves beyond aid. Stewart M. Patrick, 9/29/11.
t's rare that the head of a lumbering international organization delivers a visionary speech about a new world order. But when that person is a polymath and strategic thinker like Robert Zoellick, it pays to sit up and take notice. In a sweeping address at George Washington University earlier this month, the World Bank president identified a "critical inflection point" in world history. Global affairs have been so transformed, he suggested, that we need new paradigms for global governance and global development. Since the speech attracted little media attention, The Internationalist thought it opportune to take a closer look.....
The ground is shifting under our feet. Economic and political power is flowing to developing countries at an unprecedented speed. In the 1990s, developing countries collectively accounted for a fifth of global growth. By 2025, six of the biggest emerging economies--China, India, Brazil, South Korea, Russia and Indonesia--will account for half. Based on its current trajectory, China may quadruple its per capita income to $16,000 by 2030--"equivalent to adding sixteen South Koreas each year." For the world to absorb such dramatic changes, China and other rapid ascenders must shift from export-led to more balanced growth. Simultaneously, mature economies like the United States, the European Union, and Japan need to overcome political gridlock and make difficult fiscal choices--or face inevitable decline.
• The time has come to retire old labels and habits. Five decades after decolonization (and two after the Cold War), the shopworn labels "First World" and "Third World" and "North" and "South," make no sense. It is time to stop treating developing nations as mere aid "supplicants"--wards of the wealthy nations--and start treating them as full partners in the pursuit of shared global growth. Nor can the rich world continue to pretend that it has all the answers, patronizing developing nations with aid conditions and policy guidance when its own recent performance has been so dismal. Increasingly, developing countries are looking to one another for innovative economic ideas and development models--whether it is Brazil's successful program of conditional cash transfers or Colombia's mass transit system--and as sources of investment and even foreign aid.
• Tomorrow's multilateral order will be fluid and volatile. In the twenty-first century, global governance will be more flexible, but also more subject to shocks. Old hierarchies will be pushed aside, as emerging economies join "new networks--of countries, international institutions, civil society, and the private sector--in diverse combinations and changing patterns." Long-established patterns of Western privilege will fade: "The New Normal will be about countries continually earning their place in world economic affairs, not presuming it because of past standing or official prerogatives."
True news article - not sarcasm. The Food and Drug Administration has granted emergency use authorization to a new CONVID-19 test that can detect infections with only a sample of a patient's breath, using a device that can yield results in less than three minutes.
The InspectIR CONVID-19 Breathalyzer is a piece of equipment around the size of a piece of carry-on luggage. Each InspectIR Breathalyzer can evaluate around 160 samples every day. In a study of 2,409 people with and without symptoms, the FDA says the device was able to spot 91.2% of cases — and yielded false positives in only 0.7% of results.
InspectIR's test works by analyzing a person's breath using "gas chromatography gas mass-spectrometry" to detect "five compounds" typically exhaled when people are infected by SARS-CoV-2. Of course the article neglects to disclose the "5 compounds".
Great stuff my friend, will finish reading the article after work.
Meanwhile here in Canada our government is pre-emptively preparing a program to pay off the surviving family members (providing "funeral expenses" etc) and paying off some of the maimed victims of the clot shots they forced on everyone, and this is apparently just a program for "the first five years" of vaccine deaths and injuries they are predicting. https://tnc.news/2022/03/17/feds-prepare-75-million-for-first-five-years-of-covid-vaccine-injury-claims/
All the worlds governments are controlled by the same powers:
A Staged Russia/Ukraine Conflict Is Part of the Plan To Take Down the Current World Order
https://lionessofjudah.substack.com/p/a-staged-russiaukraine-conflict-is
This writer here -- https://astutenews.com/2022/04/the-new-world-order-that-is-being-prepared-under-the-pretext-of-war-in-ukraine/#comment-48721 -- made this observation:
"They started with the freezing of the assets of Russian oligarchs in the West, a measure that was applauded by the Russian population, which considers them illegitimate beneficiaries of the plundering of the USSR."
You've remarked on such things before, iirc, E.S.
Seems like it's time for many wolves to be tossed by their fellow wolves to their fellow wolves. If Putin's primary goal is to remain the last man standing, then his less flattering maneuvers -- from going full-bore covid-compliant to allowing so much wealth to be stolen -- make sense. Nothing else computes for me in a way that doesn't make my head want to explode like a Moshka ammunition hold.
As strong as Russia's position in so many ways is, it is nonetheless in the center of a vicious market-state vs nation-state Global Transformation War, and Putin may be wise enough to see that Russia as he knows it must politically collapse and, if so, he would logically want to have deciding power on who takes over the inescapable mess.
Either way, Russia is a mess that is well-stocked in international Brawndo: it has the abundant natural resources that global market/nation-states crave (along with a well-maintained tech infrastructure despite serious population problems); it currently can project the world's largest single military power; and it has a sense of national identity every bit as strong as China's national identity (China's national ID has yet to be re-determined after being conquered and consistently bled to death for nearly 200 years by Euromerican parasites).
Even with the several self-inflicted or merely unavoidable wounds it has taken on in recent years, Russia retains the global catbird seat and I therefore choose to believe that Putin's seemingly cretinous acquiescence to dopey death fads like Covidiotics!(r) and Trust USA to Play Fair is that of a man determined to preserve core control over an inescapable maniacal clusterfuck, one that is already waging full-blown economic and biological warfare including "Fauci's" creepy crawlers, and seems quite capable of becoming a nuclear attention-getter that might even cancel next year's Oscar ceremony.
Times are sad indeed when the best one's hopes can sustain are like some Hollywood flick where the hero has to detonate the Twin Towers himself, while inside, and survive the blast or at least die with the One Ring clutched to his vaporized breast.
I mean: Putin. As an action hero political icon, his sell-by was ten years ago when he still looked good riding bare-chested on a horse with his manly manipples budding like mojo detonator switches. I mean, hey: the dude used to be cool. Show me another superpower president doing this:
https://www.thesun.co.uk/wp-content/uploads/2016/10/nintchdbpict000145835624.jpg?w=960
Now all I get is a whiff of old man realpolitik and "maybe somebody in power still gives half a damn".
There's always a hypodermic needle in those Soviet-era cartoons of the capitalist pugs -- never quite figured out why.
Strangely, those old caricatures tell us something about today's unusual alliances. Perhaps the dawning realization that Ukraine's fighters are a stalking horse for moneyed interests who aim to profit from their fight with Russia.
https://moneycircus.substack.com/p/eurasia-note-44-azovs-last-stand
Vlad's got quite a legacy - this little bit of rather poisonous corruption, what appears to be a losing war in Ukraine because he surrounded himself with "yes men", some of whom are now cooling their heels in Lefortovo, and now the Moskva, put out of action either by a couple of Ukrainian anti-ship missiles, "incompetence", or both ...
Great inside news Edward, thank you. I shall post to my Letter next week, too late for this Saturday - it's in the can.
https://austrianpeter.substack.com/p/media-complicit-stress-in-germany?s=w
So let it be known!
Cool music (not so much news), thanks!